IN-SILICO ANALYSIS OF MTA1 AS DRUG TARGET AGAINST NATURAL ANTIOXIDANTS
HTML Full TextIN-SILICO ANALYSIS OF MTA1 AS DRUG TARGET AGAINST NATURAL ANTIOXIDANTS
Rajasekhar Pinnamaneni * 1, Prasad Gandham 2, Jahnavi Tatineni 1, Renuka Vemparala 1, Samrin Shaik 1 and Srinivasulu Kamma 1
Department of Biotechnology 1, Koneru Lakshmaiah Education Foundation, Greenfields, Vaddeswaram, Guntur - 522502, Andhra Pradesh, India.
Department of Studies and Research in Biotechnology and Centre for Bioinformation, Tumkur University, Tumkur - 572103, Karnataka, India.
ABSTRACT: The protein MTA1 with histone deacetylase activity is a member of the nucleosome remodeling complex encoded by the mta1 gene is frequently overexpressed in biologically aggressive epithelial neoplasms. MTA1 is a nuclear co-regulatory molecule that is highly expressed in many cancers and correlates with tumor metastasis and progression. MTA1 alters signaling events in the tumor micro-environment. MTA1 contributes to cancer progression, may serve as a biomarker and therapeutic target for cancer. The main objective of this study is to perform in-silico docking studies and energy minimizations for active sites of mutated MTA1 protein by selecting different naturally available antioxidant molecules in foods to facilitate ligand-binding site interactions and identify the best from the selected ligands.
| Keywords: |
MTA1, Antioxidants, Docking
INTRODUCTION: Phenotypic changes resulted from the dysregulation of genetic and epigenetic processes, including aberrant transcription of genes driven by cell survival, proliferation, immunologic functions, invasion, and metastasis is cancer 1. Sequence-specific transcription factors and associated coregulatory proteins enable highly ordered but dynamic gene transcription 2. Coregulators control transcription factor-dependent gene expression through direct binding to transcription factors and indirectly by interacting with his tones and thereby regulating the accessibility of transcription factor to DNA, resulting in the stimulation or repression of the transcription of specific genes 3.
The overexpressed oncogene in human cancer is c-myc 4 encoding c-MYC, a transcription factor that regulates the expression of downstream target genes and their expressed proteins mediate the biological activities of c-myc 5, 6. Only partial elucidation of these downstream targets was documented with c-MYC-mediated transformation 7, 8, 9.
These targets include the genes encoding the enzymes lactate dehydrogenase-A (LDH-A) and ornithine decarboxylase (ODC). Genetic evidence suggests a strict requirement in the MYC transformation pathway for both LDH and ODC 7, 8, 9. Metastasis-associated protein (MTA1) is encoded by mta1 gene in humans and is the first member of the mta family genes 10, 11. The transforming activity of c-MYC is played by an essential effect or mta1 gene. The metastasis-associated 1 (MTA1) protein 10, 12 is representative of a protein family highly conserved through evolution, which also includes the metastasis-associated 1-like protein (MTA1) 13, MTA2 14, and MTA3 15.
MTA1 is a crucial regulator of the metastatic process in both human and rodent mammary tumors 16, 17. The mta1 gene was identified to screen for genes expressed in metastatic cells, specifically, mammary adenocarcinoma cell lines and in many other tumor types as well 18, 19, 20, 21. MTA1 can be correlated with the metastatic potential of at least two types of carcinomas, although it is also expressed in many normal tissues. The role it plays in metastasis is unclear. It was initially thought to be the 70kD component of a nucleosome remodeling deacetylase complex, NuRD, but it is more likely that this component is a different but very similar protein 22. 23, 24, 25. These two proteins are so closely related, though, that they share the same types of domains. These domains include two DNA binding domains, a dimerization domain, and a domain commonly found in proteins that methylate DNA. The profile and activity of MTA1 suggest that it is involved in regulating transcription and that this may be accomplished by chromatin remodeling MTA1 shows homology with several immediate early genes 26, 27, encoding transcription factors involved in cell growth regulation. MTA1 was identified based on its overexpression in metastatic rat breast cancer 28.MTA1 expression as they relate to either the normal or the transformed cellular phenotype, it was shown that, in malignant breast epithelial cells, MTA1 expression is induced by activation of the here gulin/HER2 pathway 29.
From the previous studies on the molecular analysis of MTA1 gene, it was clear that the polymorphisms in it had led to various cancers. The present study is aimed at identifying the best antioxidant molecule to target MTA1 protein.
MATERIALS AND METHODS:
MTA1 Protein: The normal MTA1 protein accession number NM_004689.4 encoding metastasis-associated protein MTA1 iso-form MTA1 [Homo sapiens] 30 and three mutant sequences were considered and subjected for multiple sequence alignment using CLUSTAL Omega to identify the variations in the completely determining sequence (CDS). The mutation was similar in all the mutants, and therefore, the mutant MTA1 protein accession number AAH06177 encoding MTA1 protein [Homo sapiens] 31, was considered for further analysis. The sequences were retrieved from the NCBI database (www.ncbi.nlm. nih.gov).
Clustal Omega: Three or more sequences together in a computationally efficient and accurate manner are aligned by Clustal Omega, a multiple sequence alignment programs. Biologically meaningful multiple sequence alignments of divergent sequences are produced. Evolutionary relationships can be seen via viewing Cladograms or Phylograms 32.
In-silico Three Dimensional Protein Structure Prediction: The mutated MTA1 protein is not having any predicted 3-Dimentional structure available in PDB (Protein data bank). The normal MTA1 protein has a predicted structure. Then an alternative method for finding the homologous protein, i.e., ab initio modeling, was used. There is an automated server for protein modeling which searches the homologous protein by fold prediction and sequences are modeled with a high degree of accuracy. The generated model was subjected to several repeated cycles of energy minimization using SPDBV software, and the final model was subjected to stereochemical evaluation.
Three-dimensional structure prediction of protein from the amino acid sequence still remains an unsolved problem even after decades of effort. If the target protein has a homolog already solved, the task is relatively easy, and high-resolution models can be built by copying the framework of the solved structure. However, such a modeling procedure does not help answer how and why a protein adopts its specific structure. If structure homologs (occasionally analogs) do not exist or exist but cannot be identified, models have to be constructed from scratch. This procedure, called ab initio modeling, is essential for a complete solution to the protein structure prediction problem; it can also help us understand the physicochemical principle of how proteins fold in nature. Currently, the accuracy of ab initio modeling is low, and the success is limited to small proteins (<100 residues) 30.
Robetta: Robetta provides both ab initio and comparative models of protein domains. Domains without a detectable PDB homolog are modeled with the Rosetta de novo protocol 33, 34. Comparative models are built from template PDBs detected and aligned using locally installed versions of HHSEARCH/HHpred, Raptor X, and Sparks-X. Alignments are clustered, and comparative models are generated using the Rosetta CM protocol. The procedure is fully automated. Robetta is continually evaluated through CAMEO (server 11). Robetta is evaluated in the blind benchmarking experiment CASP. Features include an interactive submission interface that allows custom sequence alignments for homology modeling, constraints, local fragments, and more. It can model multi-chain complexes and provides the option for large-scale sampling. It uses the PDB100 template database, which is updated weekly, a co-evolution-based model database (MDB), and also provides the option for custom templates (https://www.bakerlab.org/).
Ligands:
Carnosine (Β-Alanyl-L-Histidine): Carnosine (beta-alanyl-L-histidine) Fig. 1 is a natural imidazole-containing compound found in the non-protein fraction of animal-derived foods 35. It’s important for muscle function. Beta-alanine supplements increase the levels of carnosine in muscles. It was hypothesized that carnosine applies these evidently restricting activities by influencing vitality digestion and additionally by protein homeostasis (proteostasis) 36. Carnosine (10-25 mM) is capable of inhibiting the catalysis of linoleic acid and phosphatidylcholine liposomal peroxidation (LPO) by the O2-dependent iron-ascorbate and lipid-peroxyl-radical-generating linoleic acid 13-monohydroperoxide (LOOH)-activated hemoglobin systems, as measured by the thiobarbituric-acid-reactive substance. Carcinine is a good scavenger of OH radicals, as detected by iron-dependent radical damage to the sugar deoxyribose. This suggests that carnosine is able to scavenge free radicals or donate hydrogen ions 37. Due to the combination of weak metal chelating (abolished by EDTA), OH, and lipid peroxyl radicals scavenging, reducing activities to liberated fatty acid and phospholipid hydroperoxides, carnosine appear to be physiological antioxidants able to efficiently protect the lipid phase of biological membranes and aqueous environments 38. The cell reinforcement system of carnosine is credited to its chelating impact against metal particles, superoxide dismutase (SOD) - like movement, and ROS and free radicals searching capacity 39. It represses the development of tumor cells and shows cancer prevention 40.
Pelletierine: Pelletierine Fig. 1 is an alkaloid that is most commonly found in a pomegranate fruit 41. This compound usually is a citraconoyl group and has a total molecular weight of 141.21 g/mol, whose chemical formula is C8H15NO. And also, most importantly, Pelletierine has an antioxidant activity, which makes it suitable to prevent, inhibit and control the activity of cancer development and progression. In fact, its anticancer properties make Pelletierine acts effectively in the intervening cell cycle, tumor proliferation, invasion and angiogenesis. It is also known to play a major role in clinical applications of other diseases that involves chronic inflammation 42. Pelletierine has been appeared to eliminate free radicals and decline macrophage oxidative stress and lipid peroxidation in living organisms such as animals and increment plasma cell reinforcement limit in old aged people due to its antioxidant activity 43.
(R)-Amygdalin: (R)-Amygdalin Fig. 1 is a cyanogenic glucoside whose chemical formula is C20H27NO11 and molecular weight is 457.4 g/mol derived from the aromatic amino acid phenylalanine. 44. It is most commonly found in almonds and Rosaceae family seeds particularly the genus Prunus, Poaceae (grasses), Fabaceae (legumes), and in other food plants, including flaxseed and manioc. Within these plants, amygdalin and the enzymes necessary to hydrolyze it are stored in separate locations so that they will mix in response to tissue damage. This provides a natural defense system 45. Amygdalin is rich in stone fruit kernels, such as almonds, apricot (14 g/kg), peach (6.8 g/kg), and plum (4-17.5 g/kg depending on variety), and also in the seeds of the apple (3 g/kg) 46. Apoptosis is a central process activated by amygdalin in cancer cells. It is suggested to stimulate the apoptotic process by upregulating the expression of Bax (proapoptotic protein) and caspase-3 and downregulating expression of Bcl-2 (anti-apoptotic protein). It also promotes the arrest of the cell cycle in G0/G1 phase and decreases the number of cells entering S and G2/M phases. Thus, it is proposed to enhance the deceleration of the cell cycle by blocking cell proliferation and growth 47.
Amygdalin is well known for its antineoplastic activity by inducing cell programmed death, which in turn makes this suitable as an anticancer drug but not as a cancer treatment 48.
FIG. 1: 2D CHEMICAL STRUCTURE OF A. Β-ALANYL-L-HISTIDINE., B. PELLETIERINE., C.(R)-AMYGDALIN
DOCKING USING AUTODOCK VINA
Docking using AutoDock Vina: All molecular docking studies were performed using a model for MTA1. To enable the docking, coordinates and parameters were obtained from ChemSpider and the protein and ligands were converted to PDBQT (Vina executable) files, via AutoDockTools (v1.5.6) 47. A grid box centred on the approximate geometric midpoint of the MTA1 with dimensions 36 × 20 × 20 (Å) was assigned as the search region for AutoDock Vina molecular docking software 48. The exhaustiveness of the search was manually set to 128, all other parameters being the default, to find the most energetically favourable poise. Visual inspection of the PDBQT output files was accomplished using PyMOL© (Schrodinger, LLC) 49.
The exhaustiveness of the search was manually set to 128, all other parameters being the default, to find the most energetically favorable poise. Visual inspection of the PDBQT output files was accomplished using PyMOL© (Schrodinger, LLC) 49.
RESULTS AND DISCUSSION:
Mta1 Protein: The normal MTA1 protein accession number NM_004689.4 and the mutant MTA1 protein accession number AAH06177 encoding MTA1 protein [Homo sapiens] were considered by performing BLASTP of NCBI. The mutant MTA1 protein was 99.16 percent, similar to the normal MTA1 protein.
Normal Sequence: >NP_004680.2 metastasis-associated protein MTA1 iso-form MTA1 [Homo sapiens] MAANMYRVGD YVYFENSSSNPYL IRRIEELNKTANGNVEAKVVCFYRRRDISSTLIALADKHATLSVCYKAGPGADNGEEGEIEEEMENPEMVDLPEKLKHQLRHRELFLSRQLESLPATHIRGKCSVTLLNETESLKSYLEREDFFFYSLVYDPQQKTLLADKGEIRVGNRYQADITDLLKEGEEDGRDQSRLETQVWEAHNPLTDKQIDQFLVVARSVGTFARALDCSSSVRQPSLHMSAAAASRDITLFHAMDTLHKNIYDISKAISALVPQGGPVLCRDEMEEWSASEANLFEEALEKYGKDFTDIQQDFLPWKSLTSIIEYYYMWKTTDRYVQQKRLKAAEAESKLKQVYIPNYNKPNPNQISVNNVKAGVVNGTGAPGQSPGAGRACESCYTTQSYQWYSWGPPNMQCRLCASCWTYWKKYGGLKMPTRLDGERPGPNRSNMSPHGLPARSSGSPKFAMKTRQAFYLHTTKLTRIARRLCREILRPWHAARHPYLPINSAAIKAECTARLPEASQSPLVLKQAVRKPLEAVLRYLETHPRPPKPDPVKSVSSVLSSLTPAKVAPVINNGSPTILGKRSYEQHNGVDGNMKKRLLMPSRGLANHGQARHMGPSRNLLLNGKSYPTKVRLIRGGSLPPVKRRRMNWIDAPDDVFYMATEETRKIRKLLSSSETKRAARRPYKPIALRQSQALPPRPPPPAPVNDEPIVIED
Mutant Sequence: >AAH06177.1 MTA1 protein [Homo sapiens] MKTRQAFYLHTTKLTRIAR RLCREILRPWHAARHPYLPINSAAIKAECTARLPEASQSPLVLKQAVRKPLEAVLRYLETHPRPPKPDPVKSVSSVLSSLTPAKVAPVINNGSPTILGKRSYEQHNGVDGNMKKRLLMPSRGTYLGLANHGQTRHMGPSRNLLLNGKSYPTKVRLIRGGSLPPVKRRRMNWIDAPDDVFYMATEETRKIRKLLSSSETKRAARRPYKPIALRQSQALPPRPPPPAPVNDEPIVIED By using CLUSTAL Omega, multiple sequence alignment of both normal MTA1 protein sequence and the mutant MTA1 protein was carried out. The results showed an insertion of four amino acids, “TYLG” after 605 amino acid residue of the normal protein. The same was noticed in all the mutant sequences retrieved from the NCBI database. Henceforth, this mutant MTA1 protein accession number AAH06177 encoding MTA1 protein [Homo sapiens] was utilized in all the further analysis Fig. 2.
FIG. 2: MULTIPLE SEQUENCE ALIGNMENT OF NORMAL AND MUTANT MTA1 PROTEIN SEQUENCES USING CLUSTAL OMEGA
AbInitio Modeling: The mutated MTA1 protein, which encodes for the metastatic tumor-associated protein, has no 3-Dimentional structure available in PDB (Protein databank), as the 3-Dimentional structure was not elucidated either by using X- ray crystallographic or NMR studies.
The protein sequence was subjected to pBLAST at NCBI and was analyzed by multiple sequence alignment. Then an alternative method for finding the homologous protein, i.e., ab initio modeling, was used. There is an automated server for protein modeling which searches the homologous protein by fold prediction, and sequence was modeled with high degree of accuracy using ROBETTA. The generated model was subjected to several repeated cycles of energy minimization using SPDBV software, and the final model was subjected to stereochemical evaluation Fig. 3.
FIG. 3: AB INITIO MODELLED STRUCTURE OF MUTATED MTA1
Protein-Ligand Interactions: Using Auto Dock Vina software, protein-ligand interaction studies carried out by performing energy minimizations to identify the best ligand that interacts with the modeled structure of mutant MTA1 protein at minimal energy states. Each ligand interaction with the mutant MTA1 protein were carried out for 20 folds to attain the minimal energy state. Out of the three ligands (R)-Amygdalin was the best with a minimal energy of -8.0 k. cal/mol.
The other two ligands, β-alanyl-L-histidine and Pelletierine were also effective against MTA1 with -4.9 k. cal/mol and -3.7 k.cal/mol binding energy.
TABLE 1: MINIMAL ENERGY STATES OF PROTEIN-LIGAND INTERACTIONS
| S. no. | Ligand | Emergy (k.cal/mol) |
| 1 | Carnosine (β-alanyl-L-histidine) | -4.9 |
| 2 | Pelletierine | -3.7 |
| 3 | (R)-Amygdalin | -8.0 |
FIG. 4: BINDING OF R-AMYGDALIN WITH MUTANT MTA1
DISCUSSION: It would be of interest to extend our docking studies to other drugs and to look at reconciling the functional effects observed with mutated MTA1 in-silico.
This requires solvating the MTA1 model prior to any docking studies. Such work is beyond the scope of the current investigation, but our docking with MTA1 permits comparison to other recent studies describing binding sites in MTA1.
CONCLUSION: It was concluded that (R)-Amygdalin was the best ligand as it showed minimal energy when compared with the other two, and therefore the metastatic progression by MTA1 can be minimized.
The other two ligands, β-alanyl-L-histidine and Pelletierine were also effective against MTA1. Recent studies have shown that amygdalin can kill cancer cells in certain cancer types; there is no enough reliable scientific evidence to show that amygdalin can treat cancer. Despite this, it still gets promoted as an alternative cancer treatment. The current work epitomizes complete inter-pretations about all known anti-cancer mechanisms of amygdalin, the possible role of naturally occurring amygdalin in fight against cancer and mistaken belief about cyanide toxicity causing the potential of amygdalin. However, well-planned clinical trials are still needed to be conducted to prove the effectiveness of this substance in-vivo and to get approval for human use. Antioxidants are chemicals that interact with and neutralize free radicals, thus preventing them from causing damage. Antioxidants are also known as “free radical scavengers.”
ACKNOWLEDGEMENT: The authors thank the management of Koneru Lakshmaiah Education Foundation for providing us the infrastructural facilities.
CONFLICTS OF INTEREST: This statement is to certify that all authors have seen and approved the manuscript being submitted. We warrant that the article is the Authors' original work. We warrant that the article has not received prior publication and is not under consideration for publication elsewhere. On behalf of all Co-Authors, the corresponding Author shall bear full responsibility for the submission.
REFERENCES:
- Hanahan D and Weinberg RA: The hallmarks of cancer. Cell 2000; 100(1): 57-70.
- McKenna NJ and O'Malley BW: Combinatorial control of gene expression by nuclear receptors and coregulators. Cell 2002; 108(4): 465-74.
- Kingston RE and Narlikar GJ: ATP-dependent remodeling and acetylation as regulators of chromatin fluidity. Genes Dev 1999; 13(18): 2339-52.
- Nesbit CE, Tersak JM and Prochownik EV: MYC oncogenes and human neoplastic disease. Oncogene 1999; 18(19): 3004-16.
- Nilsson JA and Cleveland JL: Myc pathways provoking cell suicide and cancer. 2003; 22(56): 9007-21.
- Cole MD and McMahon SB: The Myc oncoprote: A critical evaluation of transactivation and target gene regulation. Oncogene 1999; 18(19): 2916-24.
- Shim H, Dolde C, Lewis BC, Wu CS, Dang G, Jungmann RA, DallaFavera R and Dang CV: c-Myc trans activation of LDH-A: implications for tumor metabolism and growth. Proceedings of the National Academy of Sciences of the United States of America 1997; 94(13): 6658-63.
- Lewis BC, Prescott JE, Campbell SE, Shim H, Orlowski RZ and Dang CV: Tumor induction by the c-Myc target genes rcl and lactate dehydrogenase A. Cancer Res 2000; 60(21): 6178-83.
- Nilsson JA, Keller UB, Baudino TA, Yang C, Norton S, Old JA, Nilsson LM, Neale G, Kramer DL, Porter CW and Cleveland JL: Cancer Cell 2005; 7(5): 433-44.
- Toh Y, Pencil SD and Nicolson GL: A novel candidate metastasis-associated gene, mta1, differentially expressed in highly metastatic mammary adenocarcinoma cell lines. Journal of Biological Chemistry 1994; 269(37): 22958-63.
- Toh Y and Nicolson GL: Properties and clinical relevance of MTA1 protein in human cancer. Cancer Metastasis Reviews 2014; 33(4): 891-00.
- Toh Y, Pencil SD and Nicolson GL: Analysis of the complete sequence of the novel gene mta1 differentially expressed in highly metastatic mammary adenocarcinoma and breast cancer cell lines and Gene 1995; 159: 99-04.
- Futamura M, Nishimori H, Shiratsuchi T, Saji S, Nakamura Y and Tokino T: Molecular cloning, mapping, and characterization of a novel human gene, MTA1-L1, show ing homology to a metastasis-associated gene, MTA1. Journal of Human Genetics 1999; 44(1): 52-66
- Zhang Y, LeRoy G, Seelig HP, Lane WS and Reinberg D: The dermatomyositis-specific autoantigen Mi2 is a component of a complex containing histone deacetylase and nucleosome remodeling Cell 1998; 95(2): 279-89.
- Simpson A, Uitto J, Rodeck U and Mahony MG: Differential expression and sub cellular distribution of the mouse metastasis-associated proteins Mta1 and Mta3. Gene 2001; 273(1): 29-39.
- Debies MT and Welch DR: Genetic basis of human breast cancer metastasis. Journal of Mammary Gland Biology and Neoplasia 2001; 6(4): 441-51.
- Toh Y, Pencil SD and Nicolson GL: A novel candidate metastasis-associated gene, mta1, differentially expressed in highly metastatic mammary adenocarcinoma cell Journal of Biological Chemistry 1994; 269(37): 22958-63.
- Hamatsu T, Rikimaru T, Yamashita Y, Aishima S, Tanaka S, Shirabe K, Shimada M, Toh Y and Sugimachi K: The role of MTA1 gene expression in human hepatocellular carcinoma. Oncol Rep 2003; 10(3): 599-04.
- Hofer MD, Menke A, Genze F, Gierschik P and Giehl K: Expression of MTA1 promotes motility and invasiveness of PANC-1 pancreatic carcinoma cells. British Journal of Cancer 2004; 90: 455-62.
- Kumar R, Wang RA and Bagheri-Yarmand R: Emerging roles of MTA family members in human cancers. Semin Oncol 2003; 30(5): 30-37.
- Mahoney MG, Simpson A, Jost M, Noé M, Kari C, Pepe D, Choi YW, Uitto J and Rodeck U: Metastasis-associated protein (MTA1) enhances migration, invasion, and anchorage-independent survival of immortalized human keratinocytes Oncogene 2002; 21(14): 2161-70.
- Xue Y, Wong J, Moreno GT, Young MK, Cote J and Wang W: NURD, a novel complex with both ATP-dependent chromatin-remodeling and histone deacetylase activities. Mol.- Cell 1998; 2(6): 851-61.
- Bowen NJ, Fujita N, Kajita M and Wade PA: Mi-2/NuRD: Multiple complexes for many purposes. Biochim Biophys Acta 2004; 1677(1-3): 52-57
- Toh Y, Kuninaka S, Endo K, Oshiro T, Ikeda Y, Nakashima H, Baba H, Kohnoe S, Okamura T, Nicolson GL and Sugimachi K: Molecular analysis of a candidate metastasis-associated gene, MTA1: possible interaction with histone deacetylase 1. Journal of Experimental & Clinical Cancer Research 2000; 19: 105-11.
- Zhang Y, LeRoy G, Seelig HP, Lane WS and Reinberg D: The dermatomyositis-specific autoantigen Mi2 is a component of a complex containing histone deacetylase and nucleosome remodeling Cell 1998; 95(2): 279-89.
- Herman MA, Hettenbach SM, Ratliff TM, Kenyon C and Herman Ch: RKEGL-27 is similar to a metastasis-associated factor and controls cell polarity and cell migration in elegans. Development 1999; 126(5): 1055-64.
- Paterno GD, Li Y, Luchman HA, Ryan PJ and Gillespie LL: CDNA cloning of a novel, developmentally regulated immediate early gene activated by fibroblast growth factor and encoding a nuclear protein. Journal of Biological Chemistry 1997. 272(41): 25592-95.
- Toh Y, Pencil SD and Nicolson GL: A novel candidate metastasis-associated gene, mta1, differentially expressed in highly metastatic mammary adeno-carcinoma cell Journal of Biological Chemistry 1994; 269(37): 22958-63.
- Mazumdar A, Wang RA, Mishra SK, Adam L, Bagheri-Yarmand R, Mandal M, Vadlamudi RK and Kumar R: Transcriptional repression of oestrogen receptor by metastasis-associated protein 1 corepressor. Nature Cell Biology 2001; 3(1): 30-37.
- Xu X, Kong X, Liu T, Zhou L, Wu J, Fu J, Wang Y, Zhu M, Yao S, Ding Y, Ding L, Li R, Zhu X, Tang X, Zhang Y, Yang Q, Ling J and Zhou H: Metastasis-associated protein 1, modulated by miR-30c, promotes endometrial cancer progression through AKT/mTOR/4E-BP1 pathway. Gynecol Oncol 2019; 154(1): 207-17.
- Strausberg RL, Feingold EA, Grouse LH, Derge JG, Klausner RD, Collins FS, Wagner L, Shenmen CM, Schuler GD, Altschul SF, Zeeberg B, Buetow KH, Schaefer CF, Bhat NK, Hopkins RF, Jordan H, Moore T, Max SI, Wang J, Hsieh F, Diatchenko L, Marusina K, Farmer AA, Rubin GM, Hong L, Stapleton M, Soares MB, Bonaldo MF, Casavant TL, Scheetz TE, Brownstein MJ, Usdin TB, Toshiyuki S, Carninci P, Prange C, Raha SS, Loquellano NA, Peters GJ, Abramson RD, Mullahy SJ, Bosak SA, McEwan PJ, McKernan KJ, Malek JA, Gunaratne PH, Richards S, Worley KC, Hale S, Garcia AM, Gay LJ, Hulyk SW, Villalon DK, Muzny DM, Sodergren EJ, Lu X, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madan A, Young AC, Shevchenko Y, Bouffard GG, Blakesley RW, Touchman JW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Krzywinski MI, Skalska U, Smailus DE, Schnerch A, Schein JE, Jones SJ, Marra MA and Mammalian G: Collection Program Team. Generation and initial analysis of more than 15,000 full-length human and mouse CDNA sequences. Proceedings of the National Academy of Sciences of the United States of America 2002; 99(26): 16899-03.
- Sievers F, Wilm A, Dineen D, Gibson TJ, Karplus K, Li W, Lopez R, Mc William H, Remmert M, Söding J, Thompson JD and Higgins DG: Fast, scalable generation of high-quality protein multiple sequence alignments using Clustal Omega. 1. Molecular Systems Biology 2011; 7: 539.
- Simons KT, Ruczinski I, Kooperberg C, Fox B, Bystroff C and Baker D: Improved recognition of native-like protein structures using a combination of sequence-dependent and sequence-independent features of proteins. Proteins 1999; 34(1): 82-95.
- Bradley R, Greene J, Russ E, Dutra L and Westen D: A Multidimensional Meta-Analysis of Psychotherapy for PTSD. The American J of Psych 2005; 162(2): 214-27.
- Babizhayev MA: Potentiation of intraocular absorption and drug metabolism of N-acetylcarnosine lubricant eye drops: drug interaction with sight threatening lipid peroxides in the treatment for age-related eye diseases. Drug Metabolism and Drug Interactions 2009; 24(2-4): 275-24.
- Hipkiss AR: Energy metabolism, proteotoxic stress and age-related dysfunction - protection by carnosine. Molecular aspects of medicine 2011; 32(4-6): 267-78.
- Hipkiss AR, Cartwright SP, Bromley C, Gross SR and Bill RM: Carnosine can understanding its actions on energy metabolism and protein homeostasis inform its therapeutic potential. Chemistry Central Journal 2013; 7(1): 38.
- Babizhayev MA, Seguin MC, Gueyne J, Evstigneeva RP, Ageyeva EA and Zheltukhina GA: L-carnosine (beta-alanyl-L-histidine) and carcinine (beta-alanylhistamine) act as natural antioxidants with hydroxyl-radical-scavenging and lipid-peroxidase activities. Biochem J 1994; 304(Pt 2): 509-16.
- Guddati AK, Kumar G, Shapira I. Early intervention results in lower mortality in patients with cancer hospitalized for metastatic spinal cord compression. J Investig Med. 2017; 65(4):787-93.
- Sale C, Artioli GG, Gualano B, Saunders B, Hobson RM and harris RC: Carnosine from exercise performance to health. Amino acids 2013; 44(6): 1477-91.
- Jayaprakasha GK, Negi PS and Jena BS: 11 Antimicrobial activities of pomegranate. pomegranates ancient roots to modern medicine, taylor and francis group 2006; 7: 167.
- Turrini E, Ferruzzi L and Fimognari C: Potential effects of pomegranate polyphenols in cancer prevention and therapy. Oxidative Medicine and Cellular Longevity 2015; 938475-75.
- Ahmad I, Zahin M, Aqil F, Hasan S, Khan MS and Owais M: Bioactive compounds from Punica granatum, Curcuma longa and Zingiber officinale and their therapeutic potential. Drugs of the Future 2008; 33(4): 329.
- London-Shafir I, Shafir S and Eisikowitch D: Amygdalin in almond nectar and pollen - facts and possible roles. Plant Systematics and Evolution 2003; 238(1-4): 87-95.
- Mora CA, Halter JG, Adler C, Hund A, Anders H, Yu K and Stark WJ: Application of the Prunus spp. cyanide seed defense system onto wheat: Reduced Insect Feeding and Field Growth Tests. Journal of Agricultural and Food Chemistry 2016; 64 (18): 3501-17.
- Bolarinwa IF, Orfila C and Morgan MRA: Amygdalin content of seeds, kernels and food products commercially-available in the UK. Food Chemistry 2014; 152: 133-39. 89998
- Saleem M, Asif J, Asif M and Saleem U: Amygdalin from apricot kernels induces apoptosis and causes cell cycle arrest in cancer cells: an updated review. Anticancer Anti-Cancer Agents in Medicinal Chemistry 2018; 18(12):1650-55.
- Juengel E, Thomas A, Rutz J, Makarevic J, Tsaur I, Nelson K, Haferkamp A and Blaheta RA: Amygdalin inhibits the growth of renal cell carcinoma cells in-vitro. International Journal of Molecular Medicine 2015; 37(2): 526-32.
- Khunweeraphong N, Stockner T and Kuchler K: The structure of the human ABC transporter ABCG2 reveals a novel mechanism for drug extrusion Sci Rep 2017; 7: 13767.
- Zhang Y, LeRoy G, Seelig HP, Lane WS and Reinberg D: The dermatomyositis-specific autoantigen Mi2 is a component of a complex containing histone deacetylase and nucleosome remodeling Cell 1998; 95(2): 279-89.
How to cite this article:
Pinnamaneni R, Gandham P, Tatineni J, Vemparala R, Shaik S and Kamma S: In-silico analysis of MTA1 as drug target against natural antioxidants. Int J Pharm Sci & Res 2020; 12(3): 1474-81. doi: 10.13040/IJPSR.0975-8232.12(3).1474-81.
All © 2013 are reserved by International Journal of Pharmaceutical Sciences and Research. This Journal licensed under a Creative Commons Attribution-NonCommercial-ShareAlike 3.0 Unported License.
Article Information
15
1474-1481
840
1169
English
IJPSR
R. Pinnamaneni *, P. Gandham, J. Tatineni, R. Vemparala, S. Shaik and S. Kamma
Department of Biotechnology, Koneru Lakshmaiah Education Foundation, Greenfields, Vaddeswaram, Guntur, Andhra Pradesh, India.
pinnamaneniraj@yahoo.com
02 March 2020
02 June 2020
18 February 2021
10.13040/IJPSR.0975-8232.12(3).1474-81
01 March 2021









